PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi04g04540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 195aa    MW: 21858.2 Da    PI: 8.6961
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi04g04540.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.66.7e-4256132177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cq+egC++dlseak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q
  Vradi04g04540.1  56 RCQAEGCNTDLSEAKHYHRRHKVCEFHSKAATVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKTQ 132
                      6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.3E-3552118IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.18854131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.18E-3855132IPR004333Transcription factor, SBP-box
PfamPF031101.5E-3157130IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MLDYEWNSSM ILLAGNEVAD GEPDQTRRQI FDHNFSIFYR CKTVESVSTV ASNLPRCQAE  60
GCNTDLSEAK HYHRRHKVCE FHSKAATVIA AGLTQRFCQQ CSRFHLLSEF DNGKRSCRKR  120
LADHNRRRRK TQDIHKSQPS LDNVTWSSSE SGAQSSSSMK VEVSPPDYFQ QNRGTSSTSS  180
SGSLFFSSGA NLHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3248130284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150376e-99AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497496.15e-90PREDICTED: squamosa promoter-binding-like protein 8
TrEMBLV7B9255e-89V7B925_PHAVU; Uncharacterized protein
STRINGGLYMA07G14610.14e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-49squamosa promoter binding protein-like 8